PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00557g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HSF
Protein Properties Length: 61aa    MW: 6957.96 Da    PI: 8.5142
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00557g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind32.42.4e-101053246
                              HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHST CS
              HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFk 46
                              Fl k+y++++d++++++isw  ++nsfvv+d+    +  L+  +k
  Niben101Scf00557g00003.1 10 FLVKTYDMVDDPRTNKIISWGPTNNSFVVWDPPCVRQ-GLTAQWK 53
                              9********************999*******988777.6666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.108.0E-12448IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467854.22E-10544IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004150.0062660IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.0E-71046IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MPRANAPLPF LVKTYDMVDD PRTNKIISWG PTNNSFVVWD PPCVRQGLTA QWKINRADEV  60
S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600492.14e-19PREDICTED: LOW QUALITY PROTEIN: heat shock factor protein HSF8
RefseqXP_009781208.13e-19PREDICTED: LOW QUALITY PROTEIN: heat shock factor protein HSF8
SwissprotQ401527e-16HSF8_SOLLC; Heat shock factor protein HSF8
TrEMBLM1BII21e-18M1BII2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000460003e-18(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.14e-16heat shock factor 1